close

SimulationCraft 725-01

for World of Warcraft 7.2.5 Live (wow build level 24287, git build c6eb71a)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Portal to the Underworld damage increased by 33%.
Dragged to Helheim (effect#1) ap_coefficient 1.60 1.20

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 38.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00
2017-01-11 Incorrect spell level for Frozen Orb Bolt.
Frozen Orb spell_level 57.00 81.00

Mark of the Distant Army

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Set Velocity to a reasonable value.
Mark of the Distant Army prj_speed 40.00 1.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-06-26 Agony damage reduced by 5%.
Agony (effect#1) sp_coefficient 0.04 0.04 Verification Failure (0.04)
2017-06-26 Corruption damage reduced by 5%.
Corruption (effect#1) sp_coefficient 0.33 0.34 Verification Failure (0.36)
Leviathán

Leviathán : 1349328 dps, 1085922 dps to main target

  • Race: Undead
  • Class: Warlock
  • Spec: Affliction
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1349328.4 1349328.4 674.5 / 0.050% 275809.7 / 20.4% 48.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
25283.6 25283.6 Mana 0.00% 43.7 100.0% 100%
Origin https://us.api.battle.net/wow/character/malorne/Leviathán/advanced
Talents
  • 15: Malefic Grasp (Affliction Warlock)
  • 30: Contagion (Affliction Warlock)
  • 45: Demonic Circle
  • 60: Phantom Singularity
  • 75: Burning Rush
  • 90: Grimoire of Supremacy
  • 100: Soul Conduit
  • Talent Calculator
Artifact
Professions
  • tailoring: 800
  • enchanting: 800
Scale Factors for Leviathán Damage Per Second
Mastery Haste Crit Vers Int
Scale Factors 33.84 32.72 32.39 27.08 23.29
Normalized 1.45 1.40 1.39 1.16 1.00
Scale Deltas 1313 1313 1313 1313 1313
Error 0.74 0.74 0.74 0.74 0.73
Gear Ranking
Optimizers
Ranking
  • Mastery > Haste ~= Crit > Vers > Int
Pawn string ( Pawn: v1: "Leviathán": Class=Warlock, Spec=Affliction, Intellect=23.29, CritRating=32.39, HasteRating=32.72, MasteryRating=33.84, Versatility=27.08 )

Scale Factors for other metrics

Scale Factors for Leviathán Damage Per Second
Mastery Haste Crit Vers Int
Scale Factors 33.84 32.72 32.39 27.08 23.29
Normalized 1.45 1.40 1.39 1.16 1.00
Scale Deltas 1313 1313 1313 1313 1313
Error 0.74 0.74 0.74 0.74 0.73
Gear Ranking
Optimizers
Ranking
  • Mastery > Haste ~= Crit > Vers > Int
Pawn string ( Pawn: v1: "Leviathán": Class=Warlock, Spec=Affliction, Intellect=23.29, CritRating=32.39, HasteRating=32.72, MasteryRating=33.84, Versatility=27.08 )
Scale Factors for Leviathán Priority Target Damage Per Second
Mastery Haste Crit Vers Int
Scale Factors 28.77 26.80 26.27 22.09 19.05
Normalized 1.51 1.41 1.38 1.16 1.00
Scale Deltas 1313 1313 1313 1313 1313
Error 0.68 0.68 0.68 0.68 0.68
Gear Ranking
Optimizers
Ranking
  • Mastery > Haste ~= Crit > Vers > Int
Pawn string ( Pawn: v1: "Leviathán": Class=Warlock, Spec=Affliction, Intellect=19.05, CritRating=26.27, HasteRating=26.80, MasteryRating=28.77, Versatility=22.09 )
Scale Factors for Leviathán Damage Per Second (Effective)
Mastery Haste Crit Vers Int
Scale Factors 33.84 32.72 32.39 27.08 23.29
Normalized 1.45 1.40 1.39 1.16 1.00
Scale Deltas 1313 1313 1313 1313 1313
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Mastery > Haste > Crit > Vers > Int
Pawn string ( Pawn: v1: "Leviathán": Class=Warlock, Spec=Affliction, Intellect=23.29, CritRating=32.39, HasteRating=32.72, MasteryRating=33.84, Versatility=27.08 )
Scale Factors for Leviathán Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Leviathán": Class=Warlock, Spec=Affliction, )
Scale Factors for Leviathán Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Leviathán": Class=Warlock, Spec=Affliction, )
Scale Factors for Leviathán Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Leviathán": Class=Warlock, Spec=Affliction, )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Leviathán": Class=Warlock, Spec=Affliction, )
Scale Factors for Leviathán Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Leviathán": Class=Warlock, Spec=Affliction, )
Scale Factors for Leviathán Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Leviathán": Class=Warlock, Spec=Affliction, )
Scale Factors for Leviathán Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Leviathán": Class=Warlock, Spec=Affliction, )
Scale Factors for Leviathán Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Leviathán": Class=Warlock, Spec=Affliction, )
Scale Factors for LeviathánTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Leviathán": Class=Warlock, Spec=Affliction, )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Leviathán 1349328
Agony 232156 17.2% 37.7 8.15sec 1841532 1630523 Periodic 452.6 109928 288784 153473 24.3% 199.2%

Stats details: agony

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.72 0.00 452.62 452.62 1.1294 1.3206 69465178.14 69465178.14 0.00 108482.56 1630523.16
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 342.4 75.65% 109927.55 5977 196798 110099.18 98257 127149 37641696 37641696 0.00
crit 110.2 24.35% 288783.99 18612 519547 289165.01 241259 343685 31823482 31823482 0.00
 
 

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:33000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=tick_time+gcd
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.035815
  • base_td:1.00
  • dot_duration:16.38
  • base_tick_time:1.82
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Compounding Horror 15755 1.2% 45.1 6.57sec 104408 0 Direct 45.1 88806 177831 104409 17.5%  

Stats details: compounding_horror

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.06 45.06 0.00 0.00 0.0000 0.0000 4704830.68 4704830.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.16 82.47% 88806.18 26341 251451 89112.44 57905 129888 3300358 3300358 0.00
crit 7.90 17.53% 177830.75 52682 502902 178383.92 0 442322 1404473 1404473 0.00
 
 

Action details: compounding_horror

Static Values
  • id:231489
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:231489
  • name:Compounding Horror
  • school:shadow
  • tooltip:
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.320000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Corruption 138740 10.3% 34.2 8.77sec 1215988 1089322 Periodic 327.9 90819 238181 126723 24.4% 155.8%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.18 0.00 327.93 327.93 1.1163 1.4257 41556563.11 41556563.11 0.00 82180.05 1089322.48
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 248.0 75.64% 90819.09 33 157909 91069.31 80752 106579 22526333 22526333 0.00
crit 79.9 24.36% 238181.15 71 416880 238767.00 196201 292171 19030230 19030230 0.00
 
 

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:
  • description:Corrupts the target, causing $146739o1 Shadow damage over {$146739d=14 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.327750
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Drain Soul 111372 8.3% 50.6 5.84sec 659448 270688 Periodic 158.0 168424 339164 211032 25.0% 37.5%

Stats details: drain_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.58 0.00 158.05 158.05 2.4362 0.7129 33353152.26 33353152.26 0.00 270688.48 270688.48
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 118.6 75.05% 168424.24 106683 218765 168671.86 149058 190029 19976320 19976320 0.00
crit 39.4 24.95% 339163.77 213366 437531 339574.48 299411 388420 13376832 13376832 0.00
 
 

Action details: drain_soul

Static Values
  • id:198590
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198590
  • name:Drain Soul
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 seconds. Restoring ${$e1*100}% of that damage as health to the caster.
  • description:Drains the target's soul, causing $o1 Shadow damage over {$d=6 seconds}, and healing you for ${$e1*100}% of the damage done. |cFFFFFFFFGenerates 1 Soul Shard if the target dies during this effect.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.200000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Harvester of Souls 48503 3.6% 84.0 3.49sec 172747 0 Direct 83.7 147515 294965 173400 17.6%  

Stats details: harvester_of_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.99 83.68 0.00 0.00 0.0000 0.0000 14509761.55 14509761.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.99 82.44% 147515.06 107012 204307 147706.35 133638 167396 10176736 10176736 0.00
crit 14.69 17.56% 294965.30 214024 408613 295368.07 241200 374562 4333025 4333025 0.00
 
 

Action details: harvester_of_souls

Static Values
  • id:218615
  • school:shadow
  • resource:none
  • range:60.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:218615
  • name:Harvester of Souls
  • school:shadow
  • tooltip:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
  • description:Deals {$s1=1 + 130.0%} Shadow damage and heals you for {$s2=100}% of the damage dealt.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Phantom Singularity 0 (101463) 0.0% (7.5%) 7.7 41.08sec 3933130 3513730

Stats details: phantom_singularity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.72 0.00 65.81 0.00 1.1194 1.3620 0.00 0.00 0.00 309096.95 3513729.77
 
 

Action details: phantom_singularity

Static Values
  • id:205179
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205179
  • name:Phantom Singularity
  • school:shadow
  • tooltip:Dealing damage to all nearby targets every $t1 sec and healing the casting Warlock.
  • description:Places a phantom singularity above the target, which consumes the life of all enemies within $205246A2 yards, dealing ${8*{$205246s2=0 + 180.0%}} damage over {$d=16 seconds}, healing you for ${$205246e2*100}% of the damage done.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Phantom Singularity (_tick) 101463 7.5% 0.0 0.00sec 0 0 Direct 131.6 196412 392840 230809 17.5%  

Stats details: phantom_singularity_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 131.61 0.00 0.00 0.0000 0.0000 30376193.84 30376193.84 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 108.56 82.49% 196412.40 148169 282883 196683.41 173288 227785 21322720 21322720 0.00
crit 23.05 17.51% 392840.01 296337 565765 393363.58 328109 494501 9053474 9053474 0.00
 
 

Action details: phantom_singularity_tick

Static Values
  • id:205246
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205246
  • name:Phantom Singularity
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205179=Places a phantom singularity above the target, which consumes the life of all enemies within $205246A2 yards, dealing ${8*{$205246s2=0 + 180.0%}} damage over {$d=16 seconds}, healing you for ${$205246e2*100}% of the damage done.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Rend Soul 17233 1.3% 11.7 23.16sec 436812 0 Direct 11.7 371444 742419 436813 17.6%  

Stats details: rend_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.74 11.74 0.00 0.00 0.0000 0.0000 5126426.62 5126426.62 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.67 82.38% 371443.67 246948 471471 371359.98 0 471471 3591102 3591102 0.00
crit 2.07 17.62% 742418.85 493896 942942 647711.40 0 942942 1535325 1535325 0.00
 
 

Action details: rend_soul

Static Values
  • id:242834
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242834
  • name:Rend Soul
  • school:shadow
  • tooltip:
  • description:{$@spelldesc238144=Drain Soul damage has a {$h=4}% chance to rend the target's soul, dealing {$242834s1=0} Shadow damage and summoning an additional Tormented Soul.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Touch of the Grave 6743 0.5% 19.3 15.90sec 104898 0 Direct 19.3 89268 178589 104898 17.5%  

Stats details: touch_of_the_grave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.26 19.26 0.00 0.00 0.0000 0.0000 2020574.00 2020574.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.89 82.50% 89267.88 72207 119876 89353.33 77040 103614 1418613 1418613 0.00
crit 3.37 17.50% 178588.72 144414 239751 173726.04 0 239751 601961 601961 0.00
 
 

Action details: touch_of_the_grave

Static Values
  • id:127802
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:127802
  • name:Touch of the Grave
  • school:shadow
  • tooltip:
  • description:{$@spelldesc5227=Your attacks and damaging spells have a chance to drain the target, dealing ${$max($AP,$SPH)*$pctD*(1+$@versadmg)} Shadow damage and healing you for the same amount. Additionally, you can breathe underwater indefinitely.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Unstable Affliction 0 (553548) 0.0% (40.9%) 72.4 4.09sec 2281195 2081228

Stats details: unstable_affliction

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.37 0.00 0.00 0.00 1.0961 0.0000 0.00 0.00 0.00 2081227.63 2081227.63
 
 

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<5&((soul_shard>=4&!talent.contagion.enabled)|soul_shard>=5|target.time_to_die<30)
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.966000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Unstable Affliction (_1) 200168 14.8% 0.0 0.00sec 0 0 Periodic 133.0 273888 727214 449443 38.7% 57.5%

Stats details: unstable_affliction_1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 133.02 133.02 0.0000 1.2983 59785103.57 59785103.57 0.00 346182.95 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.5 61.27% 273887.59 195 442145 274413.73 230493 324330 22323953 22323953 0.00
crit 51.5 38.73% 727213.61 310 1167264 728248.09 535429 922741 37461150 37461150 0.00
 
 

Action details: unstable_affliction_1

Static Values
  • id:233490
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233490
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_2) 172475 12.8% 0.0 0.00sec 0 0 Periodic 109.8 283344 754793 469188 39.4% 47.3%

Stats details: unstable_affliction_2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 109.81 109.81 0.0000 1.2928 51519696.59 51519696.59 0.00 362940.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.5 60.58% 283343.91 148 442145 283924.27 233748 341957 18847843 18847843 0.00
crit 43.3 39.42% 754793.34 453 1167264 756087.00 573740 941948 32671853 32671853 0.00
 
 

Action details: unstable_affliction_2

Static Values
  • id:233496
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233496
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_3) 131620 9.7% 0.0 0.00sec 0 0 Periodic 82.6 286969 764077 475603 39.5% 35.2%

Stats details: unstable_affliction_3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 82.58 82.58 0.0000 1.2785 39276574.55 39276574.55 0.00 371990.10 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.9 60.46% 286969.18 195 442145 287701.81 229888 360468 14329186 14329186 0.00
crit 32.7 39.54% 764076.65 405 1167264 765764.14 545392 970155 24947389 24947389 0.00
 
 

Action details: unstable_affliction_3

Static Values
  • id:233497
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233497
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_4) 37867 2.8% 0.0 0.00sec 0 0 Periodic 24.2 279155 742633 460604 39.1% 10.5%

Stats details: unstable_affliction_4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 24.25 24.25 0.0000 1.2989 11168732.97 11168732.97 0.00 354607.98 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.8 60.85% 279155.33 242 442145 279544.78 0 442145 4118993 4118993 0.00
crit 9.5 39.15% 742632.91 461 1167264 740435.33 0 1167264 7049740 7049740 0.00
 
 

Action details: unstable_affliction_4

Static Values
  • id:233498
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233498
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Unstable Affliction (_5) 11418 0.8% 0.0 0.00sec 0 0 Periodic 7.3 276132 732912 454588 39.1% 3.2%

Stats details: unstable_affliction_5

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 7.35 7.35 0.0000 1.3024 3341192.76 3341192.76 0.00 349059.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.5 60.93% 276132.13 238 442145 231215.66 0 442145 1236652 1236652 0.00
crit 2.9 39.07% 732911.92 685 1167264 580626.43 0 1167264 2104540 2104540 0.00
 
 

Action details: unstable_affliction_5

Static Values
  • id:233499
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:233499
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc30108=Afflicts the target with $233490o1 Shadow damage over {$233490d=8 seconds}. You may afflict a target with up to {$s2=5} Unstable Afflictions at once. If dispelled, deals ${{$233490s1=0}*{$s1=400}/100} damage to the dispeller and silences them for {$196364d=4 seconds}.$?a231791[ |cFFFFFFFFRefunds $231791m1 Soul $LShard:Shards; if the target dies while afflicted.|r][]}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.966000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - infernal 123815 / 123815
Immolation 93943 7.0% 1.0 0.00sec 28145414 0 Periodic 412.3 58089 116174 68267 17.5% 99.8%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 206.16 412.29 0.0000 1.4523 28145414.48 28145414.48 0.00 94004.80 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 340.0 82.48% 58088.67 52800 72101 58121.84 54200 65690 19752754 19752754 0.00
crit 72.2 17.52% 116173.99 105599 144201 116236.23 108142 132731 8392660 8392660 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 26175 1.9% 197.3 1.52sec 39746 26200 Direct 197.3 33819 67642 39746 17.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 197.33 197.33 0.00 0.00 1.5170 0.0000 7843111.16 11530116.33 31.98 26200.12 26200.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 162.75 82.48% 33819.33 30185 43116 33847.49 32206 36770 5504102 8091552 31.98
crit 34.58 17.52% 67642.26 60370 86233 67698.27 63245 76387 2339009 3438565 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Meteor Strike 3698 0.3% 5.5 60.00sec 201539 0 Direct 11.0 85695 171380 100779 17.6%  

Stats details: meteor_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.49 10.98 0.00 0.00 0.0000 0.0000 1106726.60 1106726.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.05 82.40% 85694.96 77657 110924 85738.00 78167 102408 775438 775438 0.00
crit 1.93 17.60% 171380.25 155313 221848 150075.35 0 221848 331289 331289 0.00
 
 

Action details: meteor_strike

Static Values
  • id:171018
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time>1
Spelldata
  • id:171018
  • name:Meteor Strike
  • school:fire
  • tooltip:Stunned.
  • description:The abyssal releases a powerful burst of flames, dealing {$s1=0} Fire damage to nearby targets, and stunning them for {$d=3 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Leviathán
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Leviathán
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Leviathán
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Leviathán
  • harmful:false
  • if_expr:
 
Life Tap 7.3 31.88sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.34 0.00 0.00 0.00 1.1193 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Reap Souls 16.1 18.84sec

Stats details: reap_souls

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.15 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: reap_souls

Static Values
  • id:216698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.deadwind_harvester.remains&time>5&(buff.tormented_souls.react>=5|target.time_to_die<=buff.tormented_souls.react*(5+1.5*equipped.144364)+(buff.tormented_souls.react*(5+1.5*equipped.144364)%12*(5+1.5*equipped.144364)))
Spelldata
  • id:216698
  • name:Reap Souls
  • school:shadow
  • tooltip:
  • description:Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Accelerando 19.8 0.0 15.5sec 15.5sec 77.79% 77.79% 2.3(2.3) 19.1

Buff details

  • buff initial source:Leviathán
  • cooldown name:buff_accelerando
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:776.94

Stack Uptimes

  • accelerando_1:28.94%
  • accelerando_2:23.39%
  • accelerando_3:14.31%
  • accelerando_4:7.02%
  • accelerando_5:4.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225719
  • name:Accelerando
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc225125=Your damaging spells have a chance to grant you {$225719s1=528} Haste for {$225719d=12 seconds}, stacking up to 5 times. Stacking does not refresh duration.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
active_uas 16.4 55.1 17.9sec 0.0sec 76.10% 76.10% 0.0(0.0) 0.0

Buff details

  • buff initial source:Leviathán
  • cooldown name:buff_active_uas
  • max_stacks:20
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • active_uas_1:27.65%
  • active_uas_2:24.39%
  • active_uas_3:19.15%
  • active_uas_4:3.79%
  • active_uas_5:1.12%
  • active_uas_6:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.60% 13.60% 0.0(0.0) 1.0

Buff details

  • buff initial source:Leviathán
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Compounding Horror 45.9 87.3 6.5sec 2.2sec 65.68% 100.00% 16.8(16.8) 0.2

Buff details

  • buff initial source:Leviathán
  • cooldown name:buff_compounding_horror
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • compounding_horror_1:21.47%
  • compounding_horror_2:14.63%
  • compounding_horror_3:10.21%
  • compounding_horror_4:7.08%
  • compounding_horror_5:12.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:199281
  • name:Compounding Horror
  • tooltip:Your next Unstable Affliction instantly deals {$231489s1=0} damage.
  • description:{$@spelldesc199282=Each time Agony and Corruption deal damage, they have a {$h=10}% chance cause your next Unstable Affliction to instantly deal {$231489s1=0} Shadow damage, stacking up to {$199281u=5} times.}
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Concordance of the Legionfall 8.3 3.2 35.5sec 24.9sec 32.15% 32.15% 3.2(3.2) 8.0

Buff details

  • buff initial source:Leviathán
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4900.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Deadwind Harvester 16.1 0.0 18.8sec 18.8sec 69.90% 69.90% 0.0(0.0) 15.3

Buff details

  • buff initial source:Leviathán
  • cooldown name:buff_deadwind_harvester
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • deadwind_harvester_1:69.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216708
  • name:Deadwind Harvester
  • tooltip:Increases your damage by {$s1=10}%, and doubles the effectiveness of the other traits of the Deadwind Harvester.
  • description:{$@spelldesc216698=Consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by {$216708s1=10}% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed. |cFFFFCC99Ulthalesh|r collects Tormented Souls from each target you kill and occasionally escaped souls it previously collected.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 69.4sec 69.4sec 8.73% 8.73% 0.0(0.0) 3.2

Buff details

  • buff initial source:Leviathán
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.73%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.9sec 69.1sec 13.69% 13.69% 0.0(0.0) 3.3

Buff details

  • buff initial source:Leviathán
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.69%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 74.3sec 0.0sec 40.12% 40.12% 0.0(0.0) 2.0

Buff details

  • buff initial source:Leviathán
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:40.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 5.5 1.0 48.4sec 40.0sec 17.15% 99.84% 1.0(1.0) 5.3

Buff details

  • buff initial source:Leviathán
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • soul_harvest_1:17.15%

Trigger Attempt Success

  • trigger_pct:99.84%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=12 seconds}, increased by {$s2=4} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=36} sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Tormented Souls 16.6 27.0 18.6sec 7.2sec 66.56% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Leviathán
  • cooldown name:buff_tormented_souls
  • max_stacks:12
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • tormented_souls_1:27.62%
  • tormented_souls_2:18.33%
  • tormented_souls_3:10.59%
  • tormented_souls_4:6.65%
  • tormented_souls_5:2.11%
  • tormented_souls_6:0.76%
  • tormented_souls_7:0.31%
  • tormented_souls_8:0.13%
  • tormented_souls_9:0.05%
  • tormented_souls_10:0.02%
  • tormented_souls_11:0.01%
  • tormented_souls_12:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216695
  • name:Tormented Souls
  • tooltip:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • description:Activate Reap Souls to consume all Tormented Souls collected by |cFFFFCC99Ulthalesh|r, increasing your damage by 10% and doubling the effect of all of |cFFFFCC99Ulthalesh|r's other traits for {$216708d=5 seconds} per soul consumed.
  • max_stacks:12
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Leviathán
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Leviathán
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Leviathán
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
fatal_echos 8.6 31.3sec
soul_conduit 14.5 19.4sec
the_master_harvester 6.5 40.0sec
souls_consumed 42.8 18.8sec

Resources

Resource Usage Type Count Total Average RPE APR
Leviathán
agony Mana 37.7 1244808.0 33000.0 33000.0 55.8
corruption Mana 34.2 1127786.8 33000.0 33000.2 36.8
drain_soul Mana 158.0 5215603.6 33000.0 103121.3 6.4
unstable_affliction Soul Shard 72.4 72.4 1.0 1.0 2281212.7
Resource Gains Type Count Total Average Overflow
life_tap Mana 7.34 2422354.47 (35.82%) 330000.00 0.00 0.00%
agony Soul Shard 51.19 50.77 (72.18%) 0.99 0.42 0.81%
drain_soul Soul Shard 0.50 0.50 (0.71%) 1.00 0.00 0.00%
mp5_regen Mana 532.03 4340308.31 (64.18%) 8157.95 11202.21 0.26%
soul_conduit Soul Shard 14.46 14.46 (20.56%) 1.00 0.00 0.00%
affliction_t20_2pc Soul Shard 4.76 4.60 (6.54%) 0.97 0.15 3.22%
Resource RPS-Gain RPS-Loss
Health 0.00 10299.07
Mana 22532.89 25283.55
Soul Shard 0.23 0.24
Combat End Resource Mean Min Max
Mana 275140.21 5252.16 668996.81
Soul Shard 0.97 0.00 3.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.2%

Statistics & Data Analysis

Fight Length
Sample Data Leviathán Fight Length
Count 41479
Mean 300.12
Minimum 177.12
Maximum 440.64
Spread ( max - min ) 263.51
Range [ ( max - min ) / 2 * 100% ] 43.90%
DPS
Sample Data Leviathán Damage Per Second
Count 41479
Mean 1349328.40
Minimum 1099959.09
Maximum 1791625.89
Spread ( max - min ) 691666.81
Range [ ( max - min ) / 2 * 100% ] 25.63%
Standard Deviation 70093.1103
5th Percentile 1243916.05
95th Percentile 1473576.09
( 95th Percentile - 5th Percentile ) 229660.04
Mean Distribution
Standard Deviation 344.1606
95.00% Confidence Intervall ( 1348653.86 - 1350002.94 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 104
0.1% Error 10367
0.1 Scale Factor Error with Delta=300 41940571
0.05 Scale Factor Error with Delta=300 167762282
0.01 Scale Factor Error with Delta=300 4194057037
Priority Target DPS
Sample Data Leviathán Priority Target Damage Per Second
Count 41479
Mean 1085921.88
Minimum 874732.22
Maximum 1514762.96
Spread ( max - min ) 640030.73
Range [ ( max - min ) / 2 * 100% ] 29.47%
Standard Deviation 64866.8150
5th Percentile 987965.12
95th Percentile 1201137.74
( 95th Percentile - 5th Percentile ) 213172.62
Mean Distribution
Standard Deviation 318.4993
95.00% Confidence Intervall ( 1085297.63 - 1086546.12 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 138
0.1% Error 13708
0.1 Scale Factor Error with Delta=300 35919379
0.05 Scale Factor Error with Delta=300 143677516
0.01 Scale Factor Error with Delta=300 3591937879
DPS(e)
Sample Data Leviathán Damage Per Second (Effective)
Count 41479
Mean 1349328.40
Minimum 1099959.09
Maximum 1791625.89
Spread ( max - min ) 691666.81
Range [ ( max - min ) / 2 * 100% ] 25.63%
Damage
Sample Data Leviathán Damage
Count 41479
Mean 366203980.65
Minimum 282333916.94
Maximum 454003706.89
Spread ( max - min ) 171669789.95
Range [ ( max - min ) / 2 * 100% ] 23.44%
DTPS
Sample Data Leviathán Damage Taken Per Second
Count 41479
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Leviathán Healing Per Second
Count 41479
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Leviathán Healing Per Second (Effective)
Count 41479
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Leviathán Heal
Count 41479
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Leviathán Healing Taken Per Second
Count 41479
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Leviathán Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data LeviathánTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Leviathán Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
Default action list Executed every time the actor is available.
# count action,conditions
B 0.00 call_action_list,name=haunt,if=talent.haunt.enabled
C 0.00 call_action_list,name=writhe,if=talent.writhe_in_agony.enabled
D 0.00 call_action_list,name=mg,if=talent.malefic_grasp.enabled
actions.mg
# count action,conditions
E 3.00 reap_souls,if=!buff.deadwind_harvester.remains&time>5&(buff.tormented_souls.react>=5|target.time_to_die<=buff.tormented_souls.react*(5+1.5*equipped.144364)+(buff.tormented_souls.react*(5+1.5*equipped.144364)%12*(5+1.5*equipped.144364)))
0.00 reap_souls,if=active_enemies>1&!buff.deadwind_harvester.remains&time>5&soul_shard>0&((talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3)|spell_targets.seed_of_corruption>=5)
F 30.64 agony,cycle_targets=1,if=remains<=tick_time+gcd
0.00 service_pet,if=dot.corruption.remains&dot.agony.remains
0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
0.00 blood_fury
0.00 soul_harvest,if=buff.soul_harvest.remains<=8&buff.active_uas.stack>=2
G 1.00 potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|buff.active_uas.stack>2)
0.00 potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|buff.active_uas.stack>2)
0.00 siphon_life,if=remains<=tick_time+gcd
0.00 siphon_life,cycle_targets=1,if=active_enemies>1&remains<=tick_time+gcd&buff.active_uas.stack=0
H 20.10 corruption,if=remains<=tick_time+gcd&((spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled)|spell_targets.seed_of_corruption<5)
I 11.54 corruption,cycle_targets=1,if=active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<5)&(buff.active_uas.stack=0|equipped.132457)
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
J 0.00 reap_souls,if=(buff.deadwind_harvester.remains+buff.tormented_souls.react*(5+equipped.144364))>=(12*(5+1.5*equipped.144364))&buff.active_uas.stack<1
K 7.72 phantom_singularity
L 7.08 agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
M 7.05 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
0.00 siphon_life,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
0.00 seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=5|spell_targets.seed_of_corruption>=3&dot.corruption.remains<=cast_time+travel_time
N 2.53 corruption,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
O 14.46 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<5&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4&(equipped.132457|buff.active_uas.stack<2))
P 35.65 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<5&(soul_shard>=4|(equipped.132457&soul_shard=5))
Q 22.45 unstable_affliction,if=!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*2+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)&(!talent.siphon_life.enabled|dot.siphon_life.remains>cast_time+6.5)
0.00 unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<5&equipped.132457&(buff.active_uas.stack=0|!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction)&dot.agony.remains>cast_time+6.5
R 13.14 reap_souls,if=!buff.deadwind_harvester.remains&(buff.active_uas.stack>1|(prev_gcd.1.unstable_affliction&buff.tormented_souls.react>1))
S 0.29 life_tap,if=mana.pct<=10
T 41.70 drain_soul,chain=1,interrupt=1
0.00 life_tap

Sample Sequence

0146AFFHIKPQQETFFHIQQQTHTFFIQQQRTHNKLLQQQRTHPTPFFMPRTHTILPRTFTHKNPQTPGTRTFFHMIPOQTRTFFHIPOPPPTKHFPFQPQRTHMTILLPQQRTHPRTPFFTKPHQRTMTFFINPOQRTPTFFHIPQPRTTKMIFFHPOPTPPRTHPFFTPQTHILLMPKPPRTHTPTFFTINPQQRTFFIMHPOPTKPOOOFHOOETOTOTOTFH

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Leviathán 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food Leviathán 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 4 summon_infernal Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation Leviathán 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 mg F agony Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:01.220 mg F agony enemy2 1088865.7/1100000: 99% mana | 3.0/5: 60% soul_shard bloodlust, concordance_of_the_legionfall, accelerando, potion_of_prolonged_power
0:02.146 mg H corruption Fluffy_Pillow 1072462.0/1100000: 97% mana | 3.0/5: 60% soul_shard bloodlust, concordance_of_the_legionfall, accelerando, potion_of_prolonged_power
0:03.069 mg I corruption enemy2 1056004.7/1100000: 96% mana | 3.0/5: 60% soul_shard bloodlust, concordance_of_the_legionfall, accelerando, potion_of_prolonged_power
0:03.992 mg K phantom_singularity Fluffy_Pillow 1039547.3/1100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, concordance_of_the_legionfall, accelerando, potion_of_prolonged_power
0:04.916 mg P unstable_affliction Fluffy_Pillow 1056107.8/1100000: 96% mana | 4.0/5: 80% soul_shard bloodlust, concordance_of_the_legionfall, accelerando, potion_of_prolonged_power
0:05.841 mg Q unstable_affliction Fluffy_Pillow 1072686.3/1100000: 98% mana | 3.0/5: 60% soul_shard bloodlust, active_uas, concordance_of_the_legionfall, accelerando, potion_of_prolonged_power
0:06.764 mg Q unstable_affliction Fluffy_Pillow 1089228.9/1100000: 99% mana | 2.0/5: 40% soul_shard bloodlust, active_uas(2), concordance_of_the_legionfall, accelerando, potion_of_prolonged_power
0:07.689 mg E reap_souls Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, active_uas(3), concordance_of_the_legionfall, accelerando, potion_of_prolonged_power
0:07.689 mg T drain_soul Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, deadwind_harvester, active_uas(3), concordance_of_the_legionfall, accelerando, potion_of_prolonged_power
0:14.641 mg F agony Fluffy_Pillow 856854.1/1100000: 78% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, compounding_horror(5), active_uas, concordance_of_the_legionfall, potion_of_prolonged_power
0:15.581 mg F agony enemy2 840422.9/1100000: 76% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, compounding_horror(5), concordance_of_the_legionfall, potion_of_prolonged_power
0:16.523 mg H corruption Fluffy_Pillow 824183.1/1100000: 75% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, compounding_horror(5), concordance_of_the_legionfall, accelerando, potion_of_prolonged_power
0:17.449 mg I corruption enemy2 807779.5/1100000: 73% mana | 3.0/5: 60% soul_shard bloodlust, deadwind_harvester, compounding_horror(5), concordance_of_the_legionfall, accelerando, potion_of_prolonged_power
0:18.373 mg Q unstable_affliction Fluffy_Pillow 791340.0/1100000: 72% mana | 3.0/5: 60% soul_shard bloodlust, deadwind_harvester, compounding_horror(5), concordance_of_the_legionfall, accelerando, potion_of_prolonged_power
0:19.298 mg Q unstable_affliction Fluffy_Pillow 807918.5/1100000: 73% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, active_uas, concordance_of_the_legionfall, accelerando, potion_of_prolonged_power
0:20.222 mg Q unstable_affliction Fluffy_Pillow 824479.1/1100000: 75% mana | 1.0/5: 20% soul_shard bloodlust, deadwind_harvester, active_uas(2), concordance_of_the_legionfall, accelerando, potion_of_prolonged_power
0:21.147 mg T drain_soul Fluffy_Pillow 841057.5/1100000: 76% mana | 1.0/5: 20% soul_shard bloodlust, deadwind_harvester, active_uas(3), concordance_of_the_legionfall, accelerando, potion_of_prolonged_power
0:29.295 mg H corruption Fluffy_Pillow 560243.7/1100000: 51% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, tormented_souls, compounding_horror(5), active_uas, concordance_of_the_legionfall, potion_of_prolonged_power
0:30.235 mg T drain_soul Fluffy_Pillow 543812.5/1100000: 49% mana | 2.0/5: 40% soul_shard bloodlust, deadwind_harvester, tormented_souls, compounding_horror(5), active_uas, concordance_of_the_legionfall, potion_of_prolonged_power
0:31.673 mg F agony Fluffy_Pillow 503159.2/1100000: 46% mana | 3.0/5: 60% soul_shard bloodlust, deadwind_harvester, tormented_souls, compounding_horror(5), concordance_of_the_legionfall, potion_of_prolonged_power
0:32.613 mg F agony enemy2 486791.4/1100000: 44% mana | 3.0/5: 60% soul_shard bloodlust, deadwind_harvester, tormented_souls, compounding_horror(5), concordance_of_the_legionfall, accelerando, potion_of_prolonged_power
0:33.536 mg I corruption enemy2 470334.0/1100000: 43% mana | 3.0/5: 60% soul_shard bloodlust, tormented_souls(2), compounding_horror(5), concordance_of_the_legionfall, accelerando, potion_of_prolonged_power
0:34.460 mg Q unstable_affliction Fluffy_Pillow 453894.6/1100000: 41% mana | 3.0/5: 60% soul_shard bloodlust, tormented_souls(2), compounding_horror(5), accelerando, potion_of_prolonged_power
0:35.382 mg Q unstable_affliction Fluffy_Pillow 470419.3/1100000: 43% mana | 3.0/5: 60% soul_shard bloodlust, soul_harvest, tormented_souls(2), active_uas, accelerando, potion_of_prolonged_power
0:36.306 mg Q unstable_affliction Fluffy_Pillow 486979.8/1100000: 44% mana | 2.0/5: 40% soul_shard bloodlust, soul_harvest, tormented_souls(2), active_uas(2), accelerando, potion_of_prolonged_power
0:37.233 mg R reap_souls Fluffy_Pillow 503594.1/1100000: 46% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, tormented_souls(2), active_uas(3), accelerando, potion_of_prolonged_power
0:37.233 mg T drain_soul Fluffy_Pillow 503594.1/1100000: 46% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, deadwind_harvester, active_uas(3), accelerando, potion_of_prolonged_power
0:42.273 mg H corruption Fluffy_Pillow 323116.5/1100000: 29% mana | 2.0/5: 40% soul_shard soul_harvest, deadwind_harvester, concordance_of_the_legionfall, accelerando(2), potion_of_prolonged_power
0:43.453 mg N corruption enemy2 306653.7/1100000: 28% mana | 2.0/5: 40% soul_shard deadwind_harvester, concordance_of_the_legionfall, accelerando(2), potion_of_prolonged_power
0:44.635 mg K phantom_singularity Fluffy_Pillow 290111.4/1100000: 26% mana | 3.0/5: 60% soul_shard deadwind_harvester, compounding_horror, concordance_of_the_legionfall, potion_of_prolonged_power
0:45.856 mg L agony Fluffy_Pillow 306666.6/1100000: 28% mana | 3.0/5: 60% soul_shard deadwind_harvester, compounding_horror, concordance_of_the_legionfall, potion_of_prolonged_power
0:47.076 mg L agony enemy2 290208.3/1100000: 26% mana | 3.0/5: 60% soul_shard deadwind_harvester, compounding_horror, concordance_of_the_legionfall, potion_of_prolonged_power
0:48.295 mg Q unstable_affliction Fluffy_Pillow 273736.4/1100000: 25% mana | 3.0/5: 60% soul_shard tormented_souls, compounding_horror, concordance_of_the_legionfall, potion_of_prolonged_power
0:49.516 mg Q unstable_affliction Fluffy_Pillow 290295.0/1100000: 26% mana | 3.0/5: 60% soul_shard tormented_souls, active_uas, concordance_of_the_legionfall, accelerando, potion_of_prolonged_power
0:50.716 mg Q unstable_affliction Fluffy_Pillow 306839.0/1100000: 28% mana | 3.0/5: 60% soul_shard tormented_souls, active_uas(2), accelerando, potion_of_prolonged_power
0:51.915 mg R reap_souls Fluffy_Pillow 323369.2/1100000: 29% mana | 3.0/5: 60% soul_shard tormented_souls, active_uas(3), accelerando, potion_of_prolonged_power
0:51.915 mg T drain_soul Fluffy_Pillow 323369.2/1100000: 29% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas(3), accelerando, potion_of_prolonged_power
0:56.139 mg H corruption Fluffy_Pillow 217026.5/1100000: 20% mana | 3.0/5: 60% soul_shard deadwind_harvester, compounding_horror, active_uas(2), accelerando(2), potion_of_prolonged_power
0:57.319 mg P unstable_affliction Fluffy_Pillow 200651.0/1100000: 18% mana | 4.0/5: 80% soul_shard compounding_horror(3), active_uas, accelerando(3), potion_of_prolonged_power
0:58.481 mg T drain_soul Fluffy_Pillow 217200.8/1100000: 20% mana | 3.0/5: 60% soul_shard active_uas, accelerando(3)
1:02.597 mg P unstable_affliction Fluffy_Pillow 110073.5/1100000: 10% mana | 4.0/5: 80% soul_shard tormented_souls, compounding_horror, active_uas
1:03.818 mg F agony Fluffy_Pillow 126628.7/1100000: 12% mana | 3.0/5: 60% soul_shard tormented_souls, active_uas(2), concordance_of_the_legionfall
1:05.037 mg F agony enemy2 110156.9/1100000: 10% mana | 3.0/5: 60% soul_shard tormented_souls, active_uas, concordance_of_the_legionfall
1:06.258 mg M life_tap Fluffy_Pillow 93712.1/1100000: 9% mana | 3.0/5: 60% soul_shard tormented_souls, active_uas, concordance_of_the_legionfall
1:07.476 mg P unstable_affliction Fluffy_Pillow 440226.6/1100000: 40% mana | 4.0/5: 80% soul_shard tormented_souls, active_uas, concordance_of_the_legionfall
1:08.697 mg R reap_souls Fluffy_Pillow 456781.9/1100000: 42% mana | 3.0/5: 60% soul_shard tormented_souls, active_uas(2), concordance_of_the_legionfall
1:08.697 mg T drain_soul Fluffy_Pillow 456781.9/1100000: 42% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas(2), concordance_of_the_legionfall
1:10.494 mg H corruption Fluffy_Pillow 415424.5/1100000: 38% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas, concordance_of_the_legionfall, accelerando(2)
1:11.675 mg T drain_soul Fluffy_Pillow 398975.8/1100000: 36% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas, concordance_of_the_legionfall, accelerando(2)
1:15.831 mg I corruption enemy2 293158.7/1100000: 27% mana | 3.0/5: 60% soul_shard tormented_souls(3), compounding_horror(4), concordance_of_the_legionfall, accelerando(3)
1:16.993 mg L agony Fluffy_Pillow 276708.5/1100000: 25% mana | 3.0/5: 60% soul_shard tormented_souls(3), compounding_horror(4), concordance_of_the_legionfall, accelerando(3)
1:18.156 mg P unstable_affliction Fluffy_Pillow 260272.6/1100000: 24% mana | 4.0/5: 80% soul_shard tormented_souls(3), compounding_horror(5), concordance_of_the_legionfall, accelerando(3)
1:19.318 mg R reap_souls Fluffy_Pillow 276949.1/1100000: 25% mana | 3.0/5: 60% soul_shard tormented_souls(3), active_uas, concordance_of_the_legionfall, accelerando(4)
1:19.318 mg T drain_soul Fluffy_Pillow 276949.1/1100000: 25% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas, concordance_of_the_legionfall, accelerando(4)
1:21.103 mg F agony enemy2 236778.8/1100000: 22% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas, concordance_of_the_legionfall, accelerando(4)
1:22.248 mg T drain_soul Fluffy_Pillow 219672.8/1100000: 20% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas
1:24.141 mg H corruption Fluffy_Pillow 179339.5/1100000: 16% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), active_uas
1:25.362 mg K phantom_singularity Fluffy_Pillow 162894.7/1100000: 15% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), active_uas
1:26.584 mg N corruption enemy2 179463.5/1100000: 16% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3)
1:27.804 mg P unstable_affliction Fluffy_Pillow 163228.3/1100000: 15% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), accelerando
1:29.005 mg Q unstable_affliction Fluffy_Pillow 179786.1/1100000: 16% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, active_uas, accelerando
1:30.204 mg T drain_soul Fluffy_Pillow 196316.3/1100000: 18% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2), accelerando
1:31.993 mg P unstable_affliction Fluffy_Pillow 154980.7/1100000: 14% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas(2), accelerando
1:33.193 mg G potion Fluffy_Pillow 171524.7/1100000: 16% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), active_uas(3), accelerando
1:33.193 mg T drain_soul Fluffy_Pillow 171524.7/1100000: 16% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), active_uas(3), accelerando, potion_of_prolonged_power
1:35.075 mg R reap_souls Fluffy_Pillow 131861.1/1100000: 12% mana | 3.0/5: 60% soul_shard tormented_souls(3), compounding_horror(2), active_uas(3), accelerando(2), potion_of_prolonged_power
1:35.075 mg T drain_soul Fluffy_Pillow 131861.1/1100000: 12% mana | 3.0/5: 60% soul_shard deadwind_harvester, compounding_horror(2), active_uas(3), accelerando(2), potion_of_prolonged_power
1:37.012 mg F agony Fluffy_Pillow 93007.4/1100000: 8% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), active_uas, accelerando(2), potion_of_prolonged_power
1:38.193 mg F agony enemy2 76624.0/1100000: 7% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls, compounding_horror(5), active_uas, accelerando(3), potion_of_prolonged_power
1:39.355 mg H corruption Fluffy_Pillow 59811.4/1100000: 5% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls, compounding_horror(5), active_uas, potion_of_prolonged_power
1:40.576 mg M life_tap Fluffy_Pillow 43366.7/1100000: 4% mana | 5.0/5: 100% soul_shard deadwind_harvester, tormented_souls, compounding_horror(5), potion_of_prolonged_power
1:41.796 mg I corruption enemy2 389908.3/1100000: 35% mana | 5.0/5: 100% soul_shard deadwind_harvester, tormented_souls, compounding_horror(5), potion_of_prolonged_power
1:43.017 mg P unstable_affliction Fluffy_Pillow 373463.6/1100000: 34% mana | 5.0/5: 100% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(5), potion_of_prolonged_power
1:44.239 mg O unstable_affliction Fluffy_Pillow 390032.4/1100000: 35% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(2), active_uas, potion_of_prolonged_power
1:45.459 mg Q unstable_affliction Fluffy_Pillow 406701.0/1100000: 37% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2), accelerando, potion_of_prolonged_power
1:46.660 mg T drain_soul Fluffy_Pillow 423259.9/1100000: 38% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls(2), active_uas(3), accelerando(2), potion_of_prolonged_power
1:50.939 mg R reap_souls Fluffy_Pillow 318871.3/1100000: 29% mana | 3.0/5: 60% soul_shard tormented_souls(3), compounding_horror(2), active_uas(2), accelerando(3), potion_of_prolonged_power
1:50.939 mg T drain_soul Fluffy_Pillow 318871.3/1100000: 29% mana | 3.0/5: 60% soul_shard deadwind_harvester, compounding_horror(2), active_uas(2), accelerando(3), potion_of_prolonged_power
1:52.767 mg F agony Fluffy_Pillow 278906.6/1100000: 25% mana | 4.0/5: 80% soul_shard deadwind_harvester, compounding_horror(5), active_uas, accelerando(3), potion_of_prolonged_power
1:53.931 mg F agony enemy2 262484.9/1100000: 24% mana | 4.0/5: 80% soul_shard deadwind_harvester, compounding_horror(5), accelerando(3), potion_of_prolonged_power
1:55.093 mg H corruption Fluffy_Pillow 246164.6/1100000: 22% mana | 4.0/5: 80% soul_shard deadwind_harvester, compounding_horror(5), accelerando(4), potion_of_prolonged_power
1:56.239 mg I corruption enemy2 229747.7/1100000: 21% mana | 5.0/5: 100% soul_shard deadwind_harvester, compounding_horror(5), accelerando(4), potion_of_prolonged_power
1:57.384 mg P unstable_affliction Fluffy_Pillow 212942.8/1100000: 19% mana | 5.0/5: 100% soul_shard deadwind_harvester, tormented_souls, compounding_horror(5), potion_of_prolonged_power
1:58.604 mg O unstable_affliction Fluffy_Pillow 229484.4/1100000: 21% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls, active_uas, potion_of_prolonged_power
1:59.825 mg P unstable_affliction Fluffy_Pillow 246039.7/1100000: 22% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls, active_uas(2), potion_of_prolonged_power
2:01.045 mg P unstable_affliction Fluffy_Pillow 262581.3/1100000: 24% mana | 5.0/5: 100% soul_shard deadwind_harvester, tormented_souls, active_uas(3), potion_of_prolonged_power
2:02.264 mg P unstable_affliction Fluffy_Pillow 279205.2/1100000: 25% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls, active_uas(4), accelerando, potion_of_prolonged_power
2:03.463 mg T drain_soul Fluffy_Pillow 295735.4/1100000: 27% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, active_uas(5), accelerando, potion_of_prolonged_power
2:05.993 mg K phantom_singularity Fluffy_Pillow 231615.6/1100000: 21% mana | 3.0/5: 60% soul_shard tormented_souls, active_uas(5), accelerando, potion_of_prolonged_power
2:07.195 mg H corruption Fluffy_Pillow 248187.2/1100000: 23% mana | 3.0/5: 60% soul_shard tormented_souls, compounding_horror, active_uas(4), accelerando, potion_of_prolonged_power
2:08.395 mg F agony Fluffy_Pillow 231731.2/1100000: 21% mana | 4.0/5: 80% soul_shard tormented_souls, compounding_horror, active_uas(3), accelerando, potion_of_prolonged_power
2:09.596 mg P unstable_affliction Fluffy_Pillow 215289.0/1100000: 20% mana | 4.0/5: 80% soul_shard tormented_souls, compounding_horror(2), active_uas(3), accelerando, potion_of_prolonged_power
2:10.796 mg F agony enemy2 231833.0/1100000: 21% mana | 3.0/5: 60% soul_shard tormented_souls, active_uas(3), accelerando, potion_of_prolonged_power
2:11.996 mg Q unstable_affliction Fluffy_Pillow 215377.0/1100000: 20% mana | 3.0/5: 60% soul_shard tormented_souls, active_uas(2), accelerando, potion_of_prolonged_power
2:13.196 mg P unstable_affliction Fluffy_Pillow 231921.0/1100000: 21% mana | 4.0/5: 80% soul_shard tormented_souls, active_uas(3), accelerando, potion_of_prolonged_power
2:14.397 mg Q unstable_affliction Fluffy_Pillow 248352.8/1100000: 23% mana | 3.0/5: 60% soul_shard tormented_souls, active_uas(4), potion_of_prolonged_power
2:15.617 mg R reap_souls Fluffy_Pillow 264932.0/1100000: 24% mana | 2.0/5: 40% soul_shard tormented_souls, active_uas(4), accelerando, potion_of_prolonged_power
2:15.617 mg T drain_soul Fluffy_Pillow 264932.0/1100000: 24% mana | 2.0/5: 40% soul_shard deadwind_harvester, active_uas(4), accelerando, potion_of_prolonged_power
2:21.189 mg H corruption Fluffy_Pillow 110751.3/1100000: 10% mana | 3.0/5: 60% soul_shard compounding_horror(4), active_uas(2), nefarious_pact, accelerando, potion_of_prolonged_power
2:22.024 mg M life_tap Fluffy_Pillow 89263.2/1100000: 8% mana | 3.0/5: 60% soul_shard compounding_horror(4), active_uas, nefarious_pact, accelerando, potion_of_prolonged_power
2:22.856 mg T drain_soul Fluffy_Pillow 430733.7/1100000: 39% mana | 3.0/5: 60% soul_shard compounding_horror(4), active_uas, nefarious_pact, accelerando, potion_of_prolonged_power
2:24.204 mg I corruption enemy2 383318.1/1100000: 35% mana | 4.0/5: 80% soul_shard compounding_horror(4), nefarious_pact, accelerando, potion_of_prolonged_power
2:25.038 mg L agony Fluffy_Pillow 361955.2/1100000: 33% mana | 4.0/5: 80% soul_shard compounding_horror(4), nefarious_pact, accelerando(2), potion_of_prolonged_power
2:25.861 mg L agony enemy2 340489.3/1100000: 31% mana | 4.0/5: 80% soul_shard tormented_souls, compounding_horror(4), nefarious_pact, accelerando(2), potion_of_prolonged_power
2:26.684 mg P unstable_affliction Fluffy_Pillow 319023.3/1100000: 29% mana | 4.0/5: 80% soul_shard tormented_souls, compounding_horror(5), concordance_of_the_legionfall, nefarious_pact, accelerando(2), potion_of_prolonged_power
2:27.506 mg Q unstable_affliction Fluffy_Pillow 330518.6/1100000: 30% mana | 3.0/5: 60% soul_shard tormented_souls, active_uas, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
2:28.357 mg Q unstable_affliction Fluffy_Pillow 342057.1/1100000: 31% mana | 2.0/5: 40% soul_shard tormented_souls, active_uas(2), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
2:29.205 mg R reap_souls Fluffy_Pillow 353554.9/1100000: 32% mana | 3.0/5: 60% soul_shard tormented_souls, active_uas(3), concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
2:29.205 mg T drain_soul Fluffy_Pillow 353554.9/1100000: 32% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas(3), concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
2:34.174 mg H corruption Fluffy_Pillow 256626.5/1100000: 23% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(4), active_uas(2), concordance_of_the_legionfall, devils_due, accelerando
2:35.586 mg P unstable_affliction Fluffy_Pillow 243093.2/1100000: 22% mana | 4.0/5: 80% soul_shard tormented_souls(2), compounding_horror(4), active_uas(2), concordance_of_the_legionfall, devils_due, accelerando
2:36.997 mg R reap_souls Fluffy_Pillow 262546.2/1100000: 24% mana | 3.0/5: 60% soul_shard tormented_souls(2), active_uas(2), concordance_of_the_legionfall, devils_due, accelerando
2:36.997 mg T drain_soul Fluffy_Pillow 262546.2/1100000: 24% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas(2), concordance_of_the_legionfall, devils_due, accelerando
2:40.963 mg P unstable_affliction Fluffy_Pillow 185224.2/1100000: 17% mana | 4.0/5: 80% soul_shard deadwind_harvester, compounding_horror(2), active_uas, concordance_of_the_legionfall, accelerando
2:42.164 mg F agony Fluffy_Pillow 201805.4/1100000: 18% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas(2), concordance_of_the_legionfall, accelerando(2)
2:43.347 mg F agony enemy2 185277.1/1100000: 17% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, active_uas(2), concordance_of_the_legionfall
2:44.567 mg T drain_soul Fluffy_Pillow 168818.8/1100000: 15% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), active_uas, concordance_of_the_legionfall
2:46.403 mg K phantom_singularity Fluffy_Pillow 127712.6/1100000: 12% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(3), active_uas
2:47.625 mg P unstable_affliction Fluffy_Pillow 144281.4/1100000: 13% mana | 4.0/5: 80% soul_shard tormented_souls(3), active_uas
2:48.845 mg H corruption Fluffy_Pillow 160966.0/1100000: 15% mana | 3.0/5: 60% soul_shard tormented_souls(3), active_uas, accelerando
2:50.046 mg Q unstable_affliction Fluffy_Pillow 144523.8/1100000: 13% mana | 3.0/5: 60% soul_shard tormented_souls(3), compounding_horror, active_uas, accelerando
2:51.246 mg R reap_souls Fluffy_Pillow 161067.8/1100000: 15% mana | 2.0/5: 40% soul_shard tormented_souls(3), active_uas(2), accelerando
2:51.246 mg T drain_soul Fluffy_Pillow 161067.8/1100000: 15% mana | 2.0/5: 40% soul_shard deadwind_harvester, active_uas(2), accelerando
2:53.903 mg M life_tap Fluffy_Pillow 98699.0/1100000: 9% mana | 3.0/5: 60% soul_shard deadwind_harvester, compounding_horror(3), active_uas(2), accelerando
2:55.104 mg T drain_soul Fluffy_Pillow 445256.7/1100000: 40% mana | 3.0/5: 60% soul_shard deadwind_harvester, compounding_horror(4), active_uas(2), accelerando
2:58.535 mg F agony Fluffy_Pillow 360558.8/1100000: 33% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls, compounding_horror(5), accelerando
2:59.736 mg F agony enemy2 344262.7/1100000: 31% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls, compounding_horror(5), accelerando(2)
3:00.918 mg I corruption enemy2 327508.8/1100000: 30% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls, compounding_horror(5)
3:02.139 mg N corruption Fluffy_Pillow 311342.3/1100000: 28% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls, compounding_horror(5), accelerando
3:03.339 mg P unstable_affliction Fluffy_Pillow 294886.3/1100000: 27% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(5), accelerando
3:04.541 mg O unstable_affliction Fluffy_Pillow 311457.9/1100000: 28% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(3), active_uas, accelerando
3:05.742 mg Q unstable_affliction Fluffy_Pillow 328015.7/1100000: 30% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(3), active_uas(2), accelerando
3:06.942 mg R reap_souls Fluffy_Pillow 344560.6/1100000: 31% mana | 3.0/5: 60% soul_shard tormented_souls(3), active_uas(3), accelerando(2)
3:06.942 mg T drain_soul Fluffy_Pillow 344560.6/1100000: 31% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas(3), accelerando(2)
3:09.519 mg P unstable_affliction Fluffy_Pillow 282329.2/1100000: 26% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(4), active_uas(3), accelerando(4)
3:10.664 mg T drain_soul Fluffy_Pillow 298897.8/1100000: 27% mana | 3.0/5: 60% soul_shard soul_harvest, deadwind_harvester, tormented_souls(2), active_uas(4), accelerando(4)
3:14.614 mg F agony Fluffy_Pillow 189509.8/1100000: 17% mana | 3.0/5: 60% soul_shard soul_harvest, deadwind_harvester, tormented_souls(3), compounding_horror, active_uas
3:15.836 mg F agony enemy2 173078.6/1100000: 16% mana | 4.0/5: 80% soul_shard soul_harvest, deadwind_harvester, tormented_souls(3), compounding_horror(3), active_uas
3:17.056 mg H corruption Fluffy_Pillow 156631.7/1100000: 14% mana | 4.0/5: 80% soul_shard soul_harvest, deadwind_harvester, tormented_souls(3), compounding_horror(4), accelerando
3:18.255 mg I corruption enemy2 140161.9/1100000: 13% mana | 4.0/5: 80% soul_shard soul_harvest, deadwind_harvester, tormented_souls(3), compounding_horror(4), accelerando
3:19.456 mg P unstable_affliction Fluffy_Pillow 123907.0/1100000: 11% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(5), accelerando(2)
3:20.638 mg Q unstable_affliction Fluffy_Pillow 140651.9/1100000: 13% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(3), active_uas, concordance_of_the_legionfall, accelerando(3)
3:21.800 mg P unstable_affliction Fluffy_Pillow 157201.7/1100000: 14% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(3), active_uas(2), concordance_of_the_legionfall, accelerando(3)
3:22.962 mg R reap_souls Fluffy_Pillow 173751.4/1100000: 16% mana | 3.0/5: 60% soul_shard tormented_souls(4), active_uas(3), concordance_of_the_legionfall, accelerando(3)
3:22.962 mg T drain_soul Fluffy_Pillow 173751.4/1100000: 16% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas(3), concordance_of_the_legionfall, accelerando(3)
3:25.512 mg T drain_soul Fluffy_Pillow 111478.0/1100000: 10% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, active_uas(3), concordance_of_the_legionfall, accelerando(4)
3:27.252 mg K phantom_singularity Fluffy_Pillow 70763.0/1100000: 6% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror, active_uas(2), concordance_of_the_legionfall, accelerando(5)
3:28.377 mg M life_tap Fluffy_Pillow 87298.7/1100000: 8% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), active_uas, concordance_of_the_legionfall, accelerando(5)
3:29.502 mg I corruption enemy2 433269.1/1100000: 39% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(5), concordance_of_the_legionfall
3:30.722 mg F agony Fluffy_Pillow 416810.7/1100000: 38% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(5), concordance_of_the_legionfall
3:31.940 mg F agony enemy2 400513.3/1100000: 36% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(5), concordance_of_the_legionfall, accelerando
3:33.141 mg H corruption Fluffy_Pillow 384071.1/1100000: 35% mana | 5.0/5: 100% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(5), concordance_of_the_legionfall, accelerando
3:34.343 mg P unstable_affliction Fluffy_Pillow 367747.8/1100000: 33% mana | 5.0/5: 100% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(5), concordance_of_the_legionfall, accelerando(2)
3:35.526 mg O unstable_affliction Fluffy_Pillow 384327.0/1100000: 35% mana | 5.0/5: 100% soul_shard deadwind_harvester, tormented_souls(3), active_uas, concordance_of_the_legionfall, accelerando(2)
3:36.707 mg P unstable_affliction Fluffy_Pillow 400879.1/1100000: 36% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(3), active_uas(2), concordance_of_the_legionfall, accelerando(3)
3:37.871 mg T drain_soul Fluffy_Pillow 417457.4/1100000: 38% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(3), active_uas(3), accelerando(3)
3:41.113 mg P unstable_affliction Fluffy_Pillow 332206.7/1100000: 30% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(3), active_uas(3), accelerando(4)
3:42.257 mg P unstable_affliction Fluffy_Pillow 348760.8/1100000: 32% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(3), active_uas(4), accelerando(4)
3:43.402 mg R reap_souls Fluffy_Pillow 365067.8/1100000: 33% mana | 3.0/5: 60% soul_shard tormented_souls(3), active_uas(4)
3:43.402 mg T drain_soul Fluffy_Pillow 365067.8/1100000: 33% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas(4)
3:45.282 mg H corruption Fluffy_Pillow 324558.3/1100000: 30% mana | 4.0/5: 80% soul_shard deadwind_harvester, active_uas(3)
3:46.502 mg P unstable_affliction Fluffy_Pillow 308099.9/1100000: 28% mana | 4.0/5: 80% soul_shard deadwind_harvester, active_uas(3)
3:47.722 mg F agony Fluffy_Pillow 324641.6/1100000: 30% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas(4)
3:48.942 mg F agony enemy2 308183.3/1100000: 28% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas(2), concordance_of_the_legionfall
3:50.162 mg T drain_soul Fluffy_Pillow 291788.1/1100000: 27% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas, concordance_of_the_legionfall, accelerando
3:51.963 mg P unstable_affliction Fluffy_Pillow 250617.9/1100000: 23% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas, concordance_of_the_legionfall, accelerando
3:53.163 mg Q unstable_affliction Fluffy_Pillow 267300.0/1100000: 24% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, active_uas(2), concordance_of_the_legionfall, accelerando(2)
3:54.345 mg T drain_soul Fluffy_Pillow 283865.2/1100000: 26% mana | 2.0/5: 40% soul_shard deadwind_harvester, tormented_souls, active_uas(2), concordance_of_the_legionfall, accelerando(2)
3:59.984 mg H corruption Fluffy_Pillow 133034.5/1100000: 12% mana | 3.0/5: 60% soul_shard tormented_souls(2), compounding_horror, active_uas, concordance_of_the_legionfall, accelerando(4)
4:01.129 mg I corruption enemy2 116603.1/1100000: 11% mana | 3.0/5: 60% soul_shard tormented_souls(3), compounding_horror, concordance_of_the_legionfall, accelerando(4)
4:02.272 mg L agony Fluffy_Pillow 99790.0/1100000: 9% mana | 4.0/5: 80% soul_shard tormented_souls(3), compounding_horror, concordance_of_the_legionfall
4:03.492 mg L agony enemy2 83331.6/1100000: 8% mana | 4.0/5: 80% soul_shard tormented_souls(3), compounding_horror(2)
4:04.711 mg M life_tap Fluffy_Pillow 66859.8/1100000: 6% mana | 4.0/5: 80% soul_shard tormented_souls(3), compounding_horror(3)
4:05.932 mg P unstable_affliction Fluffy_Pillow 413415.0/1100000: 38% mana | 5.0/5: 100% soul_shard tormented_souls(3), compounding_horror(5)
4:07.154 mg K phantom_singularity Fluffy_Pillow 429983.8/1100000: 39% mana | 4.0/5: 80% soul_shard tormented_souls(3), active_uas
4:08.471 mg P unstable_affliction Fluffy_Pillow 447849.5/1100000: 41% mana | 4.0/5: 80% soul_shard tormented_souls(3), active_uas, accelerando
4:09.673 mg P unstable_affliction Fluffy_Pillow 464421.1/1100000: 42% mana | 4.0/5: 80% soul_shard tormented_souls(3), active_uas(2), accelerando
4:10.873 mg R reap_souls Fluffy_Pillow 480965.1/1100000: 44% mana | 3.0/5: 60% soul_shard tormented_souls(3), active_uas(3), accelerando
4:10.873 mg T drain_soul Fluffy_Pillow 480965.1/1100000: 44% mana | 3.0/5: 60% soul_shard deadwind_harvester, active_uas(3), accelerando
4:12.750 mg H corruption Fluffy_Pillow 440842.7/1100000: 40% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls, compounding_horror, active_uas(3), accelerando
4:13.950 mg T drain_soul Fluffy_Pillow 424386.7/1100000: 39% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(2), active_uas(2), accelerando
4:16.561 mg P unstable_affliction Fluffy_Pillow 361383.7/1100000: 33% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), active_uas(2), accelerando
4:17.761 mg T drain_soul Fluffy_Pillow 377927.7/1100000: 34% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(3), active_uas(2), accelerando
4:20.370 mg F agony Fluffy_Pillow 314897.1/1100000: 29% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(2), active_uas(2), accelerando
4:21.571 mg F agony enemy2 298337.5/1100000: 27% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(3), active_uas(2), accelerando
4:22.772 mg T drain_soul Fluffy_Pillow 281895.3/1100000: 26% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(3), active_uas, accelerando
4:24.565 mg I corruption enemy2 240856.6/1100000: 22% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(4), accelerando(2)
4:25.746 mg N corruption Fluffy_Pillow 224407.8/1100000: 20% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(3), compounding_horror(4), accelerando(2)
4:26.925 mg P unstable_affliction Fluffy_Pillow 207931.0/1100000: 19% mana | 4.0/5: 80% soul_shard tormented_souls(3), compounding_horror(4), accelerando(2)
4:28.107 mg Q unstable_affliction Fluffy_Pillow 224496.3/1100000: 20% mana | 3.0/5: 60% soul_shard tormented_souls(3), active_uas, accelerando(2)
4:29.288 mg Q unstable_affliction Fluffy_Pillow 241051.1/1100000: 22% mana | 3.0/5: 60% soul_shard tormented_souls(3), active_uas(2), accelerando(3)
4:30.450 mg R reap_souls Fluffy_Pillow 257600.9/1100000: 23% mana | 2.0/5: 40% soul_shard soul_harvest, tormented_souls(3), active_uas(3), accelerando(3)
4:30.450 mg T drain_soul Fluffy_Pillow 257600.9/1100000: 23% mana | 2.0/5: 40% soul_shard soul_harvest, deadwind_harvester, active_uas(3), accelerando(3)
4:36.082 mg F agony Fluffy_Pillow 104899.1/1100000: 10% mana | 2.0/5: 40% soul_shard soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(2), active_uas, accelerando
4:37.282 mg F agony enemy2 88553.8/1100000: 8% mana | 3.0/5: 60% soul_shard soul_harvest, deadwind_harvester, tormented_souls, compounding_horror(3), accelerando(2)
4:38.463 mg I corruption enemy2 72295.1/1100000: 7% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(4), accelerando(3)
4:39.624 mg M life_tap Fluffy_Pillow 55830.7/1100000: 5% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(4), accelerando(3)
4:40.787 mg H corruption Fluffy_Pillow 402394.7/1100000: 37% mana | 3.0/5: 60% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(4), accelerando(3)
4:41.949 mg P unstable_affliction Fluffy_Pillow 385944.5/1100000: 35% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror(4), accelerando(3)
4:43.112 mg O unstable_affliction Fluffy_Pillow 402508.6/1100000: 37% mana | 4.0/5: 80% soul_shard deadwind_harvester, tormented_souls(2), active_uas, accelerando(3)
4:44.277 mg P unstable_affliction Fluffy_Pillow 419101.1/1100000: 38% mana | 4.0/5: 80% soul_shard soul_harvest, deadwind_harvester, tormented_souls(2), active_uas(2), accelerando(3)
4:45.439 mg T drain_soul Fluffy_Pillow 435650.9/1100000: 40% mana | 3.0/5: 60% soul_shard soul_harvest, deadwind_harvester, tormented_souls(2), active_uas(3), accelerando(3)
4:47.268 mg K phantom_singularity Fluffy_Pillow 395775.4/1100000: 36% mana | 4.0/5: 80% soul_shard soul_harvest, tormented_souls(3), compounding_horror, active_uas(3)
4:48.489 mg P unstable_affliction Fluffy_Pillow 412347.9/1100000: 37% mana | 4.0/5: 80% soul_shard soul_harvest, tormented_souls(3), compounding_horror, active_uas(3), accelerando
4:49.690 mg O unstable_affliction Fluffy_Pillow 429088.1/1100000: 39% mana | 3.0/5: 60% soul_shard soul_harvest, tormented_souls(3), active_uas(3), accelerando(2)
4:50.872 mg O unstable_affliction Fluffy_Pillow 445653.3/1100000: 41% mana | 3.0/5: 60% soul_shard soul_harvest, tormented_souls(3), active_uas(3), accelerando(2)
4:52.053 mg O unstable_affliction Fluffy_Pillow 462204.5/1100000: 42% mana | 2.0/5: 40% soul_shard soul_harvest, tormented_souls(3), active_uas(3), accelerando(2)
4:53.234 mg F agony Fluffy_Pillow 478755.8/1100000: 44% mana | 2.0/5: 40% soul_shard tormented_souls(3), active_uas(4), accelerando(2)
4:54.416 mg H corruption Fluffy_Pillow 462321.0/1100000: 42% mana | 2.0/5: 40% soul_shard tormented_souls(3), active_uas(4), accelerando(2)
4:55.599 mg O unstable_affliction Fluffy_Pillow 446101.3/1100000: 41% mana | 2.0/5: 40% soul_shard tormented_souls(3), active_uas(4), accelerando(4)
4:56.745 mg O unstable_affliction Fluffy_Pillow 462783.3/1100000: 42% mana | 1.0/5: 20% soul_shard tormented_souls(3), active_uas(4), accelerando(5)
4:57.874 mg E reap_souls Fluffy_Pillow 479377.7/1100000: 44% mana | 0.0/5: 0% soul_shard tormented_souls(3), active_uas(4), accelerando(5)
4:57.874 mg T drain_soul Fluffy_Pillow 479377.7/1100000: 44% mana | 0.0/5: 0% soul_shard deadwind_harvester, active_uas(4), accelerando(5)
5:01.787 mg O unstable_affliction Fluffy_Pillow 370326.6/1100000: 34% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(3), active_uas(2), nefarious_pact
5:02.638 mg T drain_soul Fluffy_Pillow 381866.4/1100000: 35% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas(3), nefarious_pact, accelerando
5:05.715 mg O unstable_affliction Fluffy_Pillow 259738.1/1100000: 24% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls, compounding_horror(2), active_uas, nefarious_pact, accelerando(2)
5:06.538 mg T drain_soul Fluffy_Pillow 271408.9/1100000: 25% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls, active_uas(2), nefarious_pact, accelerando(3)
5:07.872 mg O unstable_affliction Fluffy_Pillow 224408.4/1100000: 20% mana | 1.0/5: 20% soul_shard deadwind_harvester, tormented_souls(2), compounding_horror, active_uas, concordance_of_the_legionfall, nefarious_pact, accelerando(3)
5:08.680 mg T drain_soul Fluffy_Pillow 236094.4/1100000: 21% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2), concordance_of_the_legionfall, nefarious_pact, accelerando(4)
5:09.958 mg F agony Fluffy_Pillow 188758.5/1100000: 17% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2), concordance_of_the_legionfall, nefarious_pact, accelerando(5)
5:10.741 mg H corruption Fluffy_Pillow 167267.3/1100000: 15% mana | 0.0/5: 0% soul_shard deadwind_harvester, tormented_souls(2), active_uas(2), concordance_of_the_legionfall, nefarious_pact, accelerando(5)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4199 3874 0
Agility 7250 6925 0
Stamina 69237 69237 41839
Intellect 57040 55334 45374 (1470)
Spirit 5 5 0
Health 4154220 4154220 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 57040 55334 0
Crit 17.53% 17.53% 5013
Haste 23.26% 23.26% 8723
Damage / Heal Versatility 3.40% 3.40% 1614
ManaReg per Second 13559 13559 0
Mastery 111.81% 108.88% 10735
Armor 2154 2154 2154
Run Speed 7 0 562

Gear

Source Slot Average Item Level: 922.00
Local Head Hood of Eternal Disdain
ilevel: 970, stats: { 324 Armor, +6250 Sta, +4166 Int, +920 Crit, +1227 Mastery }
Local Neck Clasp of Burning Demise
ilevel: 920, stats: { +2206 Sta, +2176 Crit, +1135 Haste }, enchant: { +600 Mastery }
Local Shoulders Pauldrons of Azj'Aqir
ilevel: 905, stats: { 237 Armor, +2558 Sta, +1705 Int, +766 Mastery, +496 Vers }
Local Shirt Undisputed Champion's Shirt
ilevel: 1
Local Chest The Master Harvester
ilevel: 970, stats: { 399 Armor, +6250 Sta, +4166 Int, +1150 Haste, +997 Mastery }
Local Waist Man'ari Skullbuckled Cinch
ilevel: 905, stats: { 178 Armor, +2558 Sta, +1705 Int, +713 Haste, +550 Mastery }
Local Legs Leggings of Azj'Aqir
ilevel: 895, stats: { 267 Armor, +3107 Sta, +2071 Int, +915 Crit, +706 Haste }, gems: { +150 Mastery }
Local Feet Slippers of Enduring Vigilance
ilevel: 920, stats: { 230 Armor, +2941 Sta, +1961 Int, +896 Haste, +438 Mastery }
Local Wrists Bracers of Harnessed Flame
ilevel: 905, stats: { 139 Armor, +1918 Sta, +1278 Int, +595 Mastery, +351 Crit }, gems: { +150 Mastery }
Local Hands Diabolic Gloves
ilevel: 925, stats: { 213 Armor, +3082 Sta, +2055 Int, +768 Vers, +593 Mastery }
Local Finger1 Loop of Vitriolic Intent
ilevel: 905, stats: { +1918 Sta, +2073 Haste, +950 Mastery }, enchant: { +200 Mastery }
Local Finger2 Ring of the Scoured Clan
ilevel: 920, stats: { +2206 Sta, +2365 Mastery, +946 Haste, +567 Avoidance }, enchant: { +200 Mastery }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Erratic Metronome
ilevel: 915, stats: { +2372 Int, +562 RunSpeed }, gems: { +150 Haste }
Local Back Diabolic Shroud
ilevel: 920, stats: { 167 Armor, +2206 Sta, +1470 StrAgiInt, +651 Crit, +350 Vers }, enchant: { +200 Int }
Local Main Hand Ulthalesh, the Deadwind Harvester
ilevel: 938, weapon: { 7618 - 11429, 3.6 }, stats: { +3092 Int, +4639 Sta, +954 Haste, +954 Mastery, +16869 Int }, relics: { +64 ilevels, +62 ilevels, +62 ilevels }

Talents

Level
15 Haunt (Affliction Warlock) Writhe in Agony (Affliction Warlock) Malefic Grasp (Affliction Warlock)
30 Contagion (Affliction Warlock) Absolute Corruption (Affliction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Howl of Terror (Affliction Warlock)
60 Phantom Singularity Sow the Seeds (Affliction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Death's Embrace (Affliction Warlock) Siphon Life Soul Conduit

Profile

warlock="Leviathán"
origin="https://us.api.battle.net/wow/character/malorne/Leviathán/advanced"
thumbnail="https://render-api-us.worldofwarcraft.com/static-render/us/malorne/74/125295434-avatar.jpg"
spec=affliction
level=110
race=undead
role=spell
position=back
professions=tailoring=800/enchanting=800
talents=http://us.battle.net/wow/en/tool/talent-calculator#Va!2000102
artifact=39:0:0:0:0:915:4:916:4:917:4:918:4:919:4:920:4:921:4:922:4:923:4:924:1:925:1:926:1:927:1:928:1:929:1:999:1:1353:1:1390:1:1601:4:1602:1:1603:1:1604:4:1711:1

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power

# Executed every time the actor is available.
actions=call_action_list,name=haunt,if=talent.haunt.enabled
actions+=/call_action_list,name=writhe,if=talent.writhe_in_agony.enabled
actions+=/call_action_list,name=mg,if=talent.malefic_grasp.enabled

actions.haunt=reap_souls,if=!buff.deadwind_harvester.remains&time>5&(buff.tormented_souls.react>=5|target.time_to_die<=buff.tormented_souls.react*(5+1.5*equipped.144364)+(buff.tormented_souls.react*(5+1.5*equipped.144364)%12*(5+1.5*equipped.144364)))
actions.haunt+=/reap_souls,if=debuff.haunt.remains&!buff.deadwind_harvester.remains
actions.haunt+=/reap_souls,if=active_enemies>1&!buff.deadwind_harvester.remains&time>5&soul_shard>0&((talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3)|spell_targets.seed_of_corruption>=5)
actions.haunt+=/agony,cycle_targets=1,if=remains<=tick_time+gcd
actions.haunt+=/service_pet,if=dot.corruption.remains&dot.agony.remains
actions.haunt+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions.haunt+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
actions.haunt+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions.haunt+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions.haunt+=/berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
actions.haunt+=/blood_fury
actions.haunt+=/soul_harvest,if=buff.soul_harvest.remains<=8&buff.active_uas.stack>=1
actions.haunt+=/potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|buff.active_uas.stack>2)
actions.haunt+=/potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|!cooldown.haunt.remains|buff.active_uas.stack>2)
actions.haunt+=/siphon_life,cycle_targets=1,if=remains<=tick_time+gcd
actions.haunt+=/corruption,cycle_targets=1,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<5)
actions.haunt+=/reap_souls,if=(buff.deadwind_harvester.remains+buff.tormented_souls.react*(5+equipped.144364))>=(12*(5+1.5*equipped.144364))
actions.haunt+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions.haunt+=/phantom_singularity
actions.haunt+=/haunt
actions.haunt+=/agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains
actions.haunt+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
actions.haunt+=/siphon_life,if=remains<=duration*0.3&target.time_to_die>=remains
actions.haunt+=/siphon_life,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&debuff.haunt.remains>=action.unstable_affliction_1.tick_time*6&debuff.haunt.remains>=action.unstable_affliction_1.tick_time*4
actions.haunt+=/seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=5|spell_targets.seed_of_corruption>=3&dot.corruption.remains<=cast_time+travel_time
actions.haunt+=/corruption,if=remains<=duration*0.3&target.time_to_die>=remains
actions.haunt+=/corruption,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&debuff.haunt.remains>=action.unstable_affliction_1.tick_time*6&debuff.haunt.remains>=action.unstable_affliction_1.tick_time*4
actions.haunt+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<5&((soul_shard>=4&!talent.contagion.enabled)|soul_shard>=5|target.time_to_die<30)
actions.haunt+=/unstable_affliction,cycle_targets=1,if=active_enemies>1&(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&soul_shard>=4&talent.contagion.enabled&cooldown.haunt.remains<15&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
actions.haunt+=/unstable_affliction,cycle_targets=1,if=active_enemies>1&(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&(equipped.132381|equipped.132457)&cooldown.haunt.remains<15&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
actions.haunt+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<5&talent.contagion.enabled&soul_shard>=4&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
actions.haunt+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<5&debuff.haunt.remains>=action.unstable_affliction_1.tick_time*2
actions.haunt+=/reap_souls,if=!buff.deadwind_harvester.remains&(buff.active_uas.stack>1|(prev_gcd.1.unstable_affliction&buff.tormented_souls.react>1))
actions.haunt+=/life_tap,if=mana.pct<=10
actions.haunt+=/drain_soul,chain=1,interrupt=1
actions.haunt+=/life_tap

actions.mg=reap_souls,if=!buff.deadwind_harvester.remains&time>5&(buff.tormented_souls.react>=5|target.time_to_die<=buff.tormented_souls.react*(5+1.5*equipped.144364)+(buff.tormented_souls.react*(5+1.5*equipped.144364)%12*(5+1.5*equipped.144364)))
actions.mg+=/reap_souls,if=active_enemies>1&!buff.deadwind_harvester.remains&time>5&soul_shard>0&((talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3)|spell_targets.seed_of_corruption>=5)
actions.mg+=/agony,cycle_targets=1,if=remains<=tick_time+gcd
actions.mg+=/service_pet,if=dot.corruption.remains&dot.agony.remains
actions.mg+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions.mg+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
actions.mg+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions.mg+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions.mg+=/berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
actions.mg+=/blood_fury
actions.mg+=/soul_harvest,if=buff.soul_harvest.remains<=8&buff.active_uas.stack>=2
actions.mg+=/potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|buff.active_uas.stack>2)
actions.mg+=/potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|buff.active_uas.stack>2)
actions.mg+=/siphon_life,if=remains<=tick_time+gcd
actions.mg+=/siphon_life,cycle_targets=1,if=active_enemies>1&remains<=tick_time+gcd&buff.active_uas.stack=0
actions.mg+=/corruption,if=remains<=tick_time+gcd&((spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled)|spell_targets.seed_of_corruption<5)
actions.mg+=/corruption,cycle_targets=1,if=active_enemies>1&remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<5)&(buff.active_uas.stack=0|equipped.132457)
actions.mg+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions.mg+=/reap_souls,if=(buff.deadwind_harvester.remains+buff.tormented_souls.react*(5+equipped.144364))>=(12*(5+1.5*equipped.144364))&buff.active_uas.stack<1
actions.mg+=/phantom_singularity
actions.mg+=/agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions.mg+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
actions.mg+=/siphon_life,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions.mg+=/seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=5|spell_targets.seed_of_corruption>=3&dot.corruption.remains<=cast_time+travel_time
actions.mg+=/corruption,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains&buff.active_uas.stack=0
actions.mg+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<5&(target.time_to_die<30|prev_gcd.1.unstable_affliction&soul_shard>=4&(equipped.132457|buff.active_uas.stack<2))
actions.mg+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<5&(soul_shard>=4|(equipped.132457&soul_shard=5))
actions.mg+=/unstable_affliction,if=!equipped.132457&!prev_gcd.3.unstable_affliction&dot.agony.remains>cast_time*2+6.5&(dot.corruption.remains>cast_time+6.5|talent.absolute_corruption.enabled)&(!talent.siphon_life.enabled|dot.siphon_life.remains>cast_time+6.5)
actions.mg+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<5&equipped.132457&(buff.active_uas.stack=0|!prev_gcd.3.unstable_affliction&prev_gcd.1.unstable_affliction)&dot.agony.remains>cast_time+6.5
actions.mg+=/reap_souls,if=!buff.deadwind_harvester.remains&(buff.active_uas.stack>1|(prev_gcd.1.unstable_affliction&buff.tormented_souls.react>1))
actions.mg+=/life_tap,if=mana.pct<=10
actions.mg+=/drain_soul,chain=1,interrupt=1
actions.mg+=/life_tap

actions.writhe=reap_souls,if=!buff.deadwind_harvester.remains&time>5&(buff.tormented_souls.react>=5|target.time_to_die<=buff.tormented_souls.react*(5+1.5*equipped.144364)+(buff.tormented_souls.react*(5+1.5*equipped.144364)%12*(5+1.5*equipped.144364)))
actions.writhe+=/reap_souls,if=!buff.deadwind_harvester.remains&time>5&(buff.soul_harvest.remains>(5+equipped.144364)&buff.active_uas.stack>1|buff.concordance_of_the_legionfall.react|trinket.proc.intellect.react|trinket.stacking_proc.intellect.react|trinket.proc.mastery.react|trinket.stacking_proc.mastery.react|trinket.proc.crit.react|trinket.stacking_proc.crit.react|trinket.proc.versatility.react|trinket.stacking_proc.versatility.react|trinket.proc.spell_power.react|trinket.stacking_proc.spell_power.react)
actions.writhe+=/reap_souls,if=active_enemies>1&!buff.deadwind_harvester.remains&time>5&soul_shard>0&((talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3)|spell_targets.seed_of_corruption>=5)
actions.writhe+=/agony,cycle_targets=1,if=remains<=tick_time+gcd
actions.writhe+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<5&soul_shard=5
actions.writhe+=/service_pet,if=dot.corruption.remains&dot.agony.remains
actions.writhe+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions.writhe+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>2
actions.writhe+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions.writhe+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions.writhe+=/berserking,if=prev_gcd.1.unstable_affliction|buff.soul_harvest.remains>=10
actions.writhe+=/blood_fury
actions.writhe+=/soul_harvest,if=buff.soul_harvest.remains<=8&buff.active_uas.stack>=2
actions.writhe+=/potion,name=prolonged_power,if=!talent.soul_harvest.enabled&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|buff.active_uas.stack>2)
actions.writhe+=/potion,name=prolonged_power,if=talent.soul_harvest.enabled&buff.soul_harvest.remains&(trinket.proc.any.react|trinket.stack_proc.any.react|target.time_to_die<=70|buff.active_uas.stack>2)
actions.writhe+=/siphon_life,cycle_targets=1,if=remains<=tick_time+gcd
actions.writhe+=/corruption,cycle_targets=1,if=remains<=tick_time+gcd&(spell_targets.seed_of_corruption<3&talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<5)
actions.writhe+=/reap_souls,if=(buff.deadwind_harvester.remains+buff.tormented_souls.react*(5+equipped.144364))>=(12*(5+1.5*equipped.144364))
actions.writhe+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions.writhe+=/phantom_singularity
actions.writhe+=/agony,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains
actions.writhe+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3|talent.malefic_grasp.enabled&target.time_to_die>15&mana.pct<10
actions.writhe+=/siphon_life,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains
actions.writhe+=/seed_of_corruption,if=talent.sow_the_seeds.enabled&spell_targets.seed_of_corruption>=3|spell_targets.seed_of_corruption>=5|spell_targets.seed_of_corruption>=3&dot.corruption.remains<=cast_time+travel_time
actions.writhe+=/corruption,cycle_targets=1,if=remains<=duration*0.3&target.time_to_die>=remains
actions.writhe+=/unstable_affliction,if=(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<5&(soul_shard>=4|buff.soul_harvest.remains)
actions.writhe+=/unstable_affliction,cycle_targets=1,if=active_enemies>1&(equipped.132381|equipped.132457)&(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<5&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
actions.writhe+=/unstable_affliction,if=(active_enemies>1|equipped.132457)&(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<5&talent.contagion.enabled&dot.unstable_affliction_1.remains<cast_time&dot.unstable_affliction_2.remains<cast_time&dot.unstable_affliction_3.remains<cast_time&dot.unstable_affliction_4.remains<cast_time&dot.unstable_affliction_5.remains<cast_time
actions.writhe+=/unstable_affliction,if=(active_enemies=1|(!equipped.132381&!equipped.132457))&(!talent.sow_the_seeds.enabled|spell_targets.seed_of_corruption<3)&spell_targets.seed_of_corruption<5&(buff.deadwind_harvester.remains|target.time_to_die<=20|buff.concordance_of_the_legionfall.react|trinket.proc.intellect.react|trinket.stacking_proc.intellect.react|trinket.proc.mastery.react|trinket.stacking_proc.mastery.react|trinket.proc.crit.react|trinket.stacking_proc.crit.react|trinket.proc.versatility.react|trinket.stacking_proc.versatility.react)
actions.writhe+=/reap_souls,if=!buff.deadwind_harvester.remains&buff.active_uas.stack>1
actions.writhe+=/reap_souls,if=!buff.deadwind_harvester.remains&prev_gcd.1.unstable_affliction&buff.tormented_souls.react>1
actions.writhe+=/life_tap,if=mana.pct<=10
actions.writhe+=/drain_soul,chain=1,interrupt=1
actions.writhe+=/life_tap

head=hood_of_eternal_disdain,id=132394,bonus_id=1811/3570
neck=clasp_of_burning_demise,id=147765,bonus_id=3572/1502/3337,enchant=600mastery
shoulders=pauldrons_of_azjaqir,id=138323,bonus_id=3518/1502/3528
back=diabolic_shroud,id=147181,bonus_id=3562/1502/3336,enchant=200int
chest=the_master_harvester,id=151821,bonus_id=3459/3570
shirt=undisputed_champions_shirt,id=98082
wrists=bracers_of_harnessed_flame,id=140850,bonus_id=3518/1808/1502/3528,gems=150mastery
hands=diabolic_gloves,id=147182,bonus_id=3562/1507/3336
waist=manari_skullbuckled_cinch,id=140887,bonus_id=3518/1502/3528
legs=leggings_of_azjaqir,id=138317,bonus_id=3516/1808/1492/3336,gems=150mastery
feet=slippers_of_enduring_vigilance,id=146987,bonus_id=3562/1502/3336
finger1=loop_of_vitriolic_intent,id=134530,bonus_id=3418/1557/3337,enchant=200mastery
finger2=ring_of_the_scoured_clan,id=140897,bonus_id=3517/40/1517/3337,enchant=200mastery
trinket1=whispers_in_the_dark,id=140809,bonus_id=3519/1507/3528
trinket2=erratic_metronome,id=140792,bonus_id=3444/1808/42/1512/3337,gems=150haste
main_hand=ulthalesh_the_deadwind_harvester,id=128942,bonus_id=747,gem_id=147109/151189/147109/0,relic_id=3562:1502:3336/3562:1497:3528/3562:1497:3528/0

# Gear Summary
# gear_ilvl=921.53
# gear_stamina=41839
# gear_intellect=45374
# gear_crit_rating=5013
# gear_haste_rating=8723
# gear_mastery_rating=10735
# gear_versatility_rating=1614
# gear_speed_rating=562
# gear_avoidance_rating=567
# gear_armor=2154
# set_bonus=tier19_2pc=1
# set_bonus=tier20_2pc=1
default_pet=felhunter

Simulation & Raid Information

Iterations: 41487
Threads: 8
Confidence: 95.00%
Fight Length: 177 - 441 ( 300.1 )

Performance:

Total Events Processed: 279986957
Max Event Queue: 57
Sim Seconds: 12451186
CPU Seconds: 343.6562
Physical Seconds: 50.6823
Speed Up: 36232

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Leviathán Leviathán agony ticks -980 69465178 231551 90.52 109928 288784 37.7 452.6 24.3% 0.0% 0.0% 0.0% 8.15sec 69465178 300.12sec
Leviathán Leviathán augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.12sec
Leviathán Leviathán compounding_horror 231489 4704831 15676 9.01 88806 177831 45.1 45.1 17.5% 0.0% 0.0% 0.0% 6.57sec 4704831 300.12sec
Leviathán Leviathán corruption ticks -172 41556563 138522 65.59 90819 238181 34.2 327.9 24.4% 0.0% 0.0% 0.0% 8.77sec 41556563 300.12sec
Leviathán Leviathán drain_soul ticks -198590 33353152 111177 31.61 168424 339164 50.6 158.0 25.0% 0.0% 0.0% 0.0% 5.84sec 33353152 300.12sec
Leviathán Leviathán flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.12sec
Leviathán Leviathán food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.12sec
Leviathán Leviathán harvester_of_souls 218615 14509762 48346 16.73 147515 294965 84.0 83.7 17.6% 0.0% 0.0% 0.0% 3.49sec 14509762 300.12sec
Leviathán Leviathán life_tap 1454 0 0 0.00 0 0 7.3 0.0 0.0% 0.0% 0.0% 0.0% 31.88sec 0 300.12sec
Leviathán Leviathán phantom_singularity 205179 0 0 0.00 0 0 7.7 0.0 0.0% 0.0% 0.0% 0.0% 41.08sec 0 300.12sec
Leviathán Leviathán phantom_singularity_tick 205246 30376194 101213 26.31 196412 392840 0.0 131.6 17.5% 0.0% 0.0% 0.0% 0.00sec 30376194 300.12sec
Leviathán Leviathán potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.12sec
Leviathán Leviathán reap_souls 216698 0 0 0.00 0 0 16.1 0.0 0.0% 0.0% 0.0% 0.0% 18.84sec 0 300.12sec
Leviathán Leviathán rend_soul 242834 5126427 17081 2.35 371444 742419 11.7 11.7 17.6% 0.0% 0.0% 0.0% 23.16sec 5126427 300.12sec
Leviathán Leviathán summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.12sec
Leviathán Leviathán touch_of_the_grave 127802 2020574 6732 3.85 89268 178589 19.3 19.3 17.5% 0.0% 0.0% 0.0% 15.90sec 2020574 300.12sec
Leviathán Leviathán unstable_affliction 30108 0 0 0.00 0 0 72.4 0.0 0.0% 0.0% 0.0% 0.0% 4.09sec 0 300.12sec
Leviathán Leviathán unstable_affliction_1 ticks -233490 59785104 199284 26.60 273888 727214 0.0 133.0 38.7% 0.0% 0.0% 0.0% 0.00sec 59785104 300.12sec
Leviathán Leviathán unstable_affliction_2 ticks -233496 51519697 171732 21.96 283344 754793 0.0 109.8 39.4% 0.0% 0.0% 0.0% 0.00sec 51519697 300.12sec
Leviathán Leviathán unstable_affliction_3 ticks -233497 39276575 130922 16.52 286969 764077 0.0 82.6 39.5% 0.0% 0.0% 0.0% 0.00sec 39276575 300.12sec
Leviathán Leviathán unstable_affliction_4 ticks -233498 11168733 37229 4.85 279155 742633 0.0 24.2 39.1% 0.0% 0.0% 0.0% 0.00sec 11168733 300.12sec
Leviathán Leviathán unstable_affliction_5 ticks -233499 3341193 11137 1.47 276132 732912 0.0 7.3 39.1% 0.0% 0.0% 0.0% 0.00sec 3341193 300.12sec
Leviathán Leviathán_infernal immolation ticks -19483 28145414 93818 41.23 58089 116174 1.0 206.2 17.5% 0.0% 0.0% 0.0% 0.00sec 28145414 300.12sec
Leviathán Leviathán_infernal melee 0 7843111 26133 39.45 33819 67642 197.3 197.3 17.5% 0.0% 0.0% 0.0% 1.52sec 11530116 300.12sec
Leviathán Leviathán_infernal meteor_strike 171018 1106727 3688 2.20 85695 171380 5.5 11.0 17.6% 0.0% 0.0% 0.0% 60.00sec 1106727 300.12sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
1080146.6 1080146.6 Health 0.00% 0.0 100.0% 100%
Scale Factors for Fluffy_Pillow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking

Scale Factors for other metrics

Scale Factors for Fluffy_Pillow Damage Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Priority Target Damage Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Damage Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_PillowTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 8.96% 8.96% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:8.96%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.81% 10.81% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.80% 10.80% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.80%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.78% 10.78% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.78%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.77% 10.77% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.77%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.48% 10.48% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.48%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.18% 10.18% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.18%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.39% 10.39% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.39%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 8.44% 8.44% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:8.44%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 8.38% 8.38% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:8.38%

Trigger Attempt Success

  • trigger_pct:100.00%
Agony 1.0 244.6 24.6sec 1.2sec 100.00% 100.00% 235.6(235.6) 0.0

Buff details

  • buff initial source:Leviathán
  • cooldown name:buff_agony
  • max_stacks:10
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • agony_1:0.50%
  • agony_2:0.36%
  • agony_3:0.36%
  • agony_4:0.36%
  • agony_5:0.36%
  • agony_6:0.35%
  • agony_7:0.35%
  • agony_8:0.35%
  • agony_9:0.35%
  • agony_10:96.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:980
  • name:Agony
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 1080146.60
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Deaths

death count 45071
death count pct 108.64
avg death time 300.26
min death time 177.12
max death time 440.64
dmg taken 324386315.54

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 41479
Mean 300.12
Minimum 177.12
Maximum 440.64
Spread ( max - min ) 263.51
Range [ ( max - min ) / 2 * 100% ] 43.90%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 41479
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 41479
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 41479
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 41479
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 41479
Mean 1085921.88
Minimum 874732.22
Maximum 1514762.96
Spread ( max - min ) 640030.73
Range [ ( max - min ) / 2 * 100% ] 29.47%
Standard Deviation 64866.8150
5th Percentile 987965.12
95th Percentile 1201137.74
( 95th Percentile - 5th Percentile ) 213172.62
Mean Distribution
Standard Deviation 318.4993
95.00% Confidence Intervall ( 1085297.63 - 1086546.12 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 138
0.1% Error 13708
0.1 Scale Factor Error with Delta=300 35919379
0.05 Scale Factor Error with Delta=300 143677516
0.01 Scale Factor Error with Delta=300 3591937879
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 41479
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 41479
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 41479
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 41479
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 259405476 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
spec=unknown
level=113
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
262971.8 262971.8 Health 0.00% 0.0 100.0% 100%
Scale Factors for enemy2 Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking

Scale Factors for other metrics

Scale Factors for enemy2 Damage Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for enemy2 Priority Target Damage Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for enemy2 Damage Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for enemy2 Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for enemy2 Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for enemy2 Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for enemy2 Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for enemy2 Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for enemy2 Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for enemy2 Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for enemy2Theck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.1 0.0 0.0sec 0.0sec 0.42% 0.42% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:0.42%

Trigger Attempt Success

  • trigger_pct:10.50%
Health Decade (10 - 20) 0.6 0.0 0.0sec 0.0sec 4.06% 4.06% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:4.06%

Trigger Attempt Success

  • trigger_pct:58.01%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.74% 10.74% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.74%

Trigger Attempt Success

  • trigger_pct:95.87%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 13.13% 13.13% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:13.13%

Trigger Attempt Success

  • trigger_pct:99.94%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 13.25% 13.25% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:13.25%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 12.96% 12.96% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:12.96%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 12.75% 12.75% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:12.75%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 12.97% 12.97% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:12.97%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 10.67% 10.67% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:10.67%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 9.05% 9.05% 0.0(0.0) 0.0

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:9.05%

Trigger Attempt Success

  • trigger_pct:100.00%
Agony 1.0 243.7 150.9sec 1.2sec 99.58% 99.58% 234.7(234.7) 0.0

Buff details

  • buff initial source:Leviathán
  • cooldown name:buff_agony
  • max_stacks:10
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • agony_1:0.37%
  • agony_2:0.36%
  • agony_3:0.36%
  • agony_4:0.36%
  • agony_5:0.35%
  • agony_6:0.35%
  • agony_7:0.35%
  • agony_8:0.35%
  • agony_9:0.34%
  • agony_10:96.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:980
  • name:Agony
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Damage increases over time.
  • description:Inflicts increasing agony on the target, causing up to ${$o1*{$u=6}} Shadow damage over {$d=18 seconds}. Damage starts low and increases over the duration. Refreshing Agony maintains its current damage level. |cFFFFFFFFAgony damage sometimes generates 1 Soul Shard.|r
  • max_stacks:6
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
enemy2
Resource RPS-Gain RPS-Loss
Health 0.00 262971.84
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Deaths

death count 190
death count pct 0.46
avg death time 311.02
min death time 244.70
max death time 415.85
dmg taken 78912917.35

Statistics & Data Analysis

Fight Length
Sample Data enemy2 Fight Length
Count 41479
Mean 300.08
Minimum 177.12
Maximum 440.64
Spread ( max - min ) 263.51
Range [ ( max - min ) / 2 * 100% ] 43.91%
DPS
Sample Data enemy2 Damage Per Second
Count 41479
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data enemy2 Priority Target Damage Per Second
Count 41479
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data enemy2 Damage Per Second (Effective)
Count 41479
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data enemy2 Damage
Count 41479
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data enemy2 Damage Taken Per Second
Count 41479
Mean 263444.57
Minimum 203025.66
Maximum 329206.43
Spread ( max - min ) 126180.78
Range [ ( max - min ) / 2 * 100% ] 23.95%
Standard Deviation 15138.4452
5th Percentile 239562.75
95th Percentile 289257.04
( 95th Percentile - 5th Percentile ) 49694.29
Mean Distribution
Standard Deviation 74.3305
95.00% Confidence Intervall ( 263298.88 - 263590.25 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 127
0.1% Error 12685
0.1 Scale Factor Error with Delta=300 1956349
0.05 Scale Factor Error with Delta=300 7825394
0.01 Scale Factor Error with Delta=300 195634848
HPS
Sample Data enemy2 Healing Per Second
Count 41479
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data enemy2 Healing Per Second (Effective)
Count 41479
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data enemy2 Heal
Count 41479
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data enemy2 Healing Taken Per Second
Count 41479
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data enemy2 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data enemy2Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data enemy2 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 76151170 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy2"
spec=unknown
level=113
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.